Host taxon 10090
Protein NP_473437.2
toll/interleukin-1 receptor domain-containing adapter protein
Mus musculus
Gene Tirap, UniProt Q99JY1
>NP_473437.2|Yersinia pseudotuberculosis IP 32953|toll/interleukin-1 receptor domain-containing adapter protein
MVSLEACTMASSSSVPASSTPSKKPRDKIADWFRQALLKKPKKMPISQESHLYDGSQTATQDGLSPSSCSSPPSHSSPESRSSPSSCSSGMSPTSPPTHVDSSSSSSGRWSKDYDVCVCHSEEDLEAAQELVSYLEGSQASLRCFLQLRDAAPGGAIVSELCQALSRSHCRVLLITPGFLRDPWCKYQMLQALTEAPASEGCTIPLLSGLSRAAYPPELRFMYYVDGRGKDGGFYQVKEAVIHYLETLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.18 | 1.17838342467581 | 3.9e-8 | 28096329 | |
Retrieved 1 of 4 entries in 0.5 ms
(Link to these results)