Host taxon 10090
Protein NP_001170910.1
TLD domain-containing protein 2
Mus musculus
Gene Tldc2, UniProt E9PZS3
>NP_001170910.1|Yersinia pseudotuberculosis IP 32953|TLD domain-containing protein 2
MKGWQWRYTQLPTEMEDTLSGEEGEEEEEEEPAPAPAPQDPVEPQLTEASQVLGASEIKQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQMEGHSGPVLLLLRDQDGQMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSGSGQFGLWLDGDLYHGGSYPCATFNNEVLARREQFCIKELEAWVLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.78 | -0.784551285387773 | 0.022 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)