Host taxon 10090
Protein NP_033390.1
tissue factor pathway inhibitor 2 precursor
Mus musculus
Gene Tfpi2, UniProt O35536
>NP_033390.1|Yersinia pseudotuberculosis IP 32953|tissue factor pathway inhibitor 2 precursor
MDPAMPLQLWNLPLLLVGSVLGLTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFWKHLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.77 | 1.77187034199968 | 0.0026 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)