Host taxon 10090
Protein NP_067253.1
thymosin beta-4
Mus musculus
Gene Tmsb4x, UniProt P20065
>NP_067253.1|Yersinia pseudotuberculosis IP 32953|thymosin beta-4
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.55 | 0.551126152769675 | 0.019 | 28096329 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)