Host taxon 10090
Protein NP_001034481.1
thymosin beta-10
Mus musculus
Gene Tmsb10, UniProt Q6ZWY8
>NP_001034481.1|Yersinia pseudotuberculosis IP 32953|thymosin beta-10
MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.63 | 2.62657065818085 | 3.4e-13 | 28096329 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)