Host taxon 10090
Protein NP_001157997.1
thiosulfate:glutathione sulfurtransferase
Mus musculus
Gene Tstd1, UniProt E9PY03
>NP_001157997.1|Yersinia pseudotuberculosis IP 32953|thiosulfate:glutathione sulfurtransferase
MLRLAVLRHSHTSAAAGTMAGVPTVSFSELRSLVASGRARLFDVRSPEEAAAGTIPGALNIPVSELEIALNMDPAAFQTLYCAEKPKLEDKNLIFFCQMGRRGLQATQLAQGLGYTGARNYAGAYKEWLEKQG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.66 | -1.66397044567697 | 1.3e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)