Host taxon 10090
Protein NP_742051.1
thioredoxin domain-containing protein 9
Mus musculus
Gene Txndc9, UniProt Q9CQ79
>NP_742051.1|Yersinia pseudotuberculosis IP 32953|thioredoxin domain-containing protein 9
MEGNGSVDMFSEVLENQFLQAAKLVENHLDSEIQKLDQIGEDELELLKEKRLAALRKAQQQKQEWLSKGHGEYREIGSERDFFQEVKESEKVVCHFYRDTTFRCKILDRHLAILAKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALLRDGKTQDYVVGFTDLGNTDDFTTETLEWRLGCSDVINYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.84 | 0.83805323859076 | 0.011 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)