Host taxon 10090
Protein NP_079610.1
thioredoxin domain-containing protein 12 precursor
Mus musculus
Gene Txndc12, UniProt Q9CQU0
>NP_079610.1|Yersinia pseudotuberculosis IP 32953|thioredoxin domain-containing protein 12 precursor
MSLRFGATCLLSFSFLLLITSSDGRTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.78 | 0.775907994471709 | 0.014 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)