Host taxon 10090
Protein NP_001162150.1
tetraspanin-8
Mus musculus
Gene Tspan8, UniProt Q8R3G9
>NP_001162150.1|Yersinia pseudotuberculosis IP 32953|tetraspanin-8
MAGVSSCLKYSMFFFNFLFWVCGTLILGLAIWVRVSKDGKEIITSGDSSTNPFIAVNILIAVGSIIMVLGFLGCCGAVKESRCMLLLFFIGLLLILILQVAAGILGAAFKPEYNRILNETLYENAKLLSDNTDEAKDFQKAMIVFQSEFKCCGLENGAADWGNNFVEAKESCQCTGTDCATYQGSSVYPKTCLSLIKDLFEKNIIIVIGIAFGLAVIEILGLVFSMVLYCQIGSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.66 | -0.66485097578475 | 6.2e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)