Host taxon 10090
Protein NP_079635.1
tetraspanin-13
Mus musculus
Gene Tspan13, UniProt Q9D8C2
>NP_079635.1|Yersinia pseudotuberculosis IP 32953|tetraspanin-13
MVCGGFSCSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNREQQGQLLEVGWNNTASARNDIQRNLNCCGFRSYNPNDTCPASCAKSTQKCSSCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.75 | -0.751594960481539 | 2.4e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)