Host taxon 10090
Protein NP_035736.2
tetranectin precursor
Mus musculus
Gene Clec3b, UniProt Q8CFZ6
>NP_035736.2|Yersinia pseudotuberculosis IP 32953|tetranectin precursor
MGFWGTYLLFCLFSFLSQVIAESPTPKAKKAANAKKDLVSSKMFEELKNRMDVLAQEVALLKEKQALQTVCLKGTKVNLKCLLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQFAIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.66 | -2.65626615468803 | 2.2e-9 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)