Bacterial taxon 273123
Protein WP_002209078.1
TerD family protein
Yersinia pseudotuberculosis IP 32953
Gene terD, UniProt Q66FI0
>WP_002209078.1|Yersinia pseudotuberculosis IP 32953|TerD family protein
MGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDASAFLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNRTGEGEGDDESLKIKLPLIPADVDKIVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGELYRHNAEWKFRAVGQGYAGGLSSVCAQYGINAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.79 | 1.78779862581497 | 1.3e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.61 | -1.61006465551931 | 7.9e-12 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.38 | -1.38281327976173 | 1.2e-11 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.28 | 1.27996658819958 | 0.00013 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.8 ms
(Link to these results)