Host taxon 10090
Protein NP_079605.1
tctex1 domain-containing protein 2 isoform 1
Mus musculus
Gene Tctex1d2, UniProt Q9CQ66
>NP_079605.1|Yersinia pseudotuberculosis IP 32953|tctex1 domain-containing protein 2 isoform 1
MAVSFRGLSLSAHSEGLSEVDKNSGEPENTYILRPIFQQRFRPSVVKDCIHTVLKEELASAEYSPDEMPQLTKRLSEMIKDKLKELGYDRYKMVVQVVIGEQRGEGVFMAARCFWDADTDNYTHDVFMNDSLFCVVAAFGCFYY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.01 | 1.01092607594927 | 0.04 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)