Bacterial taxon 273123
Protein WP_011193132.1
tagaturonate reductase
Yersinia pseudotuberculosis IP 32953
Gene uxaB, UniProt Q665N9
>WP_011193132.1|Yersinia pseudotuberculosis IP 32953|tagaturonate reductase
MQTLNRRDFPGRSHPDKIIQFGEGNFLRAFVDWQIDLLNEHTDLNAGIVVIRPIDTDFPPSLSTQDGLYTAVIRGLNEQGEAVRESRLIRSVNREINIYRQFDDYLALARDANIRFMFSNTTEAGIAWNEADQFSDAPPSSFPAKLTRLLFERFEHFDGAADKGWVLLPCELIDYNGEALRELVLRYASHWQLPAAFTHWLTENNTFCSTLVDRIVTGYPRDEVAALQTELGYQDSFLDTAEYFYLFVIQGPQGLAQELRLDQLDLNVRIVDDIKPYKERKVAILNGAHTALVPVAYLSGLDTVGQTMDDAQISRFVEKTITEEIVPVLELPEDELLSFSQAVLSRFRNPFIQHQLLSIALNGMTKFRTRILPQLLTYQQQKGQLPPRLTFALAALIAFYRGEREGQTYPLQDDAHWLERYSTLWNGVKHGDIALAELVNRVLSDANHWGQDLTAVPQLANQVTEQLQTILSRGMRAAVAAYS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.68 | 2.68341232885839 | 1.6e-5 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.87 | 1.87419899012082 | 0.0012 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.86 | 1.86261265910368 | 1.5e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.55 | 1.55127490450592 | 0.00032 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.8 ms
(Link to these results)