Host taxon 10090
Protein NP_001074579.1
T-cell surface glycoprotein CD8 alpha chain isoform 1 precursor
Mus musculus
Gene Cd8a, UniProt P01731
>NP_001074579.1|Yersinia pseudotuberculosis IP 32953|T-cell surface glycoprotein CD8 alpha chain isoform 1 precursor
MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.3 | -1.29604474716773 | 1.1e-8 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)