Host taxon 10090
Protein NP_033980.1
T-cell surface glycoprotein CD3 gamma chain precursor
Mus musculus
Gene Cd3g, UniProt P11942
>NP_033980.1|Yersinia pseudotuberculosis IP 32953|T-cell surface glycoprotein CD3 gamma chain precursor
MEQRKGLAGLFLVISLLQGTVAQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTISGFIFAEVISIFFLALGVYLIAGQDGVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLRKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.35 | -1.34508230804875 | 1.9e-5 | 28096329 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)