Host taxon 10090
Protein NP_031674.1
T-cell surface glycoprotein CD3 epsilon chain precursor
Mus musculus
Gene Cd3e, UniProt P22646
>NP_031674.1|Yersinia pseudotuberculosis IP 32953|T-cell surface glycoprotein CD3 epsilon chain precursor
MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.6 | -0.604937921866673 | 0.041 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)