Host taxon 10090
Protein NP_035651.1
syndecan-4 precursor
Mus musculus
Gene Sdc4, UniProt O35988
>NP_035651.1|Yersinia pseudotuberculosis IP 32953|syndecan-4 precursor
MAPACLLAPLLLLLLGGFPLVPGESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.48 | 0.484520791125956 | 0.013 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)