Bacterial taxon 273123
Protein WP_002212321.1
sulfurtransferase complex subunit TusC
Yersinia pseudotuberculosis IP 32953
Gene tusC, UniProt Q664R2
>WP_002212321.1|Yersinia pseudotuberculosis IP 32953|sulfurtransferase complex subunit TusC
MARKRIAFIFTQGPHGSSAGREGLDALLATSALSEDIGVFFISDGVLQLLPQQQPEKILARNYIATFGVLPLYDVENCYLCERSLQQRGLSKMADWILDVTVLSPADLRRELGTYDVVLTF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.35 | 3.35446583551767 | 4.8e-47 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.47 | 2.46862646590082 | 1.3e-29 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.86 | 1.86405795040769 | 1.6e-12 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.77 | 0.766088285032145 | 0.0072 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 1 ms
(Link to these results)