Host taxon 10090
Protein NP_080124.1
succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
Mus musculus
Gene Sdhd, UniProt Q9CXV1
>NP_080124.1|Yersinia pseudotuberculosis IP 32953|succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
MAVLLKLGVLCSGQGARALLLRSRVVRPAYVSAFLQDQPTQGRCGTQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGLGQVVTDYVHGDTLPKAARAGLLALSALTFAGLCYFNYHDVGICRAVAMLWKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.55 | -0.55106025076375 | 0.02 | 28096329 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)