Host taxon 10090
Protein NP_079597.2
succinate dehydrogenase cytochrome b560 subunit, mitochondrial precursor
Mus musculus
Gene Sdhc, UniProt Q9CZB0
>NP_079597.2|Yersinia pseudotuberculosis IP 32953|succinate dehydrogenase cytochrome b560 subunit, mitochondrial precursor
MAAFLLRHVSRHCLRAHLNAQLCIRNAAPLGTTAKEEMERFWKKNTSSNRPLSPHLTIYKWSLPMALSVCHRGSGIALSGGVSLFGLSALLLPGNFESYLMFVKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVWLSGVAVVVLAVLSSGGLAAL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.03 | -1.02618606669851 | 2.5e-8 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)