Bacterial taxon 273123
Protein WP_002210722.1
succinate dehydrogenase cytochrome b556 subunit
Yersinia pseudotuberculosis IP 32953
Gene sdhC, UniProt Q66DA6
>WP_002210722.1|Yersinia pseudotuberculosis IP 32953|succinate dehydrogenase cytochrome b556 subunit
MGKTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILLWLLGLSVSSQEGFMQAATIMNSFFVKFIFWGILTALAYHICGGIRHLLMDFGYLEENLAVGTRSAQVAMGLTLVLSVLAGVLVW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.08 | -4.07982823418802 | 8.9e-28 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.07 | -4.07096937195608 | 4.8e-22 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.02 | -4.01884853945778 | 1.1e-17 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.82 | -2.81956883164796 | 1.6e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 1 ms
(Link to these results)