Host taxon 10090
Protein NP_038683.1
stromal cell-derived factor 1 isoform beta precursor
Mus musculus
Gene Cxcl12, UniProt P40224
>NP_038683.1|Yersinia pseudotuberculosis IP 32953|stromal cell-derived factor 1 isoform beta precursor
MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.8 | 0.797775501620127 | 4.6e-5 | 28096329 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)