Host taxon 10090
Protein NP_079564.1
stefin-3
Mus musculus
Gene Stfa3, UniProt P35173
>NP_079564.1|Yersinia pseudotuberculosis IP 32953|stefin-3
MSQENLKIKGGLSEARPATPEIQMIADKVRPLLEEQTNEKYEKFEAVEYKSQVVAGQNLFIKIDVGNGCFLHMKVFRGLSGEDDLKLKGYQTNKTKTDELTSM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 5.55 | 5.54833587372234 | 2.0e-10 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)