Host taxon 10090
Protein NP_001076014.1
stefin-2
Mus musculus
Gene Stfa2, UniProt P35174
>NP_001076014.1|Yersinia pseudotuberculosis IP 32953|stefin-2
MTEYTIEIIGGLSEARPATSEIQEIADKVRPLLEEKTNEKYEKFKAIEYKVQVVQGLNYFIKMNVGRGCYLHINVLSGISSENDLELTGYQTNKAKNDELTYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6.84 | 6.83663629861794 | 1.5e-15 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)