Host taxon 10090
Protein NP_064374.1
START domain-containing protein 10 isoform 2
Mus musculus
Gene Stard10, UniProt Q9JMD3
>NP_064374.1|Yersinia pseudotuberculosis IP 32953|START domain-containing protein 10 isoform 2
MEKPAASTEPQGSRPALGRESVQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVTESREERAGGAGGEGSDDDTSLT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.55 | -1.54808619855977 | 2.5e-7 | 28096329 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)