Host taxon 10090
Protein NP_001297477.1
SOSS complex subunit B2 isoform b
Mus musculus
Gene Nabp1, UniProt Q8BGW5
>NP_001297477.1|Yersinia pseudotuberculosis IP 32953|SOSS complex subunit B2 isoform b
MWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNRGVQNEQKDKLSTNTFGPVGNGDQTGPESRGYHLPYGRSNGPGPISPQLPGTPSSQTVRTTISNARDPRRAFKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.14 | 1.14141753168452 | 8.0e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)