Host taxon 10090
Protein NP_083670.1
sorting nexin-24
Mus musculus
Gene Snx24, UniProt Q9CRB0
>NP_083670.1|Yersinia pseudotuberculosis IP 32953|sorting nexin-24
MEVYIPSFRHEDSDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFFSHLQPR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.04 | 1.04032485734273 | 0.0065 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)