Host taxon 10090
Protein NP_579932.1
small ubiquitin-related modifier 2 precursor
Mus musculus
Gene Sumo2, UniProt P61957
>NP_579932.1|Yersinia pseudotuberculosis IP 32953|small ubiquitin-related modifier 2 precursor
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.69 | 2.6907160970768 | 0.0064 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)