Host taxon 10090
Protein NP_001182525.1
small leucine-rich protein 1
Mus musculus
Gene Smlr1, UniProt J3QMJ4
>NP_001182525.1|Yersinia pseudotuberculosis IP 32953|small leucine-rich protein 1
MSSVLAIFLQELPGPVLVLGIFLPVTLLLLLLLAYFRIKLMAVEEELAHTSDRQNKFGSSLRKRMR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.01 | -3.00789745717663 | 2.9e-7 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)