Host taxon 10090
Protein NP_765984.1
small integral membrane protein 7 precursor
Mus musculus
Gene Smim7, UniProt Q5RKS2
>NP_765984.1|Yersinia pseudotuberculosis IP 32953|small integral membrane protein 7 precursor
MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESKEPSTGDNIREFLLSLRYFRIFIALWNVFMMLCMIVLFGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.69 | -0.693540664323994 | 0.0025 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)