Host taxon 10090
Protein NP_598894.1
small integral membrane protein 3
Mus musculus
Gene Smim3, UniProt Q99PE5
>NP_598894.1|Yersinia pseudotuberculosis IP 32953|small integral membrane protein 3
MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.83 | 0.834851635087834 | 0.0077 | 28096329 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)