Host taxon 10090
Protein NP_001138905.1
small integral membrane protein 20
Mus musculus
Gene Smim20, UniProt D3Z7Q2
>NP_001138905.1|Yersinia pseudotuberculosis IP 32953|small integral membrane protein 20
MAAARNLRTALIFGGFISMVGAAFYPIYFRPLMRLEEYQKEQAVNRAGIVQEDVQPPGLKVWSDPFGRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.65 | -0.647281417736364 | 0.018 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)