Host taxon 10090
Protein NP_001041715.1
small integral membrane protein 15
Mus musculus
Gene Smim15, UniProt Q3UTD9
>NP_001041715.1|Yersinia pseudotuberculosis IP 32953|small integral membrane protein 15
MLDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKRLKKD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.82 | 0.816162238879468 | 0.0027 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)