Host taxon 10090
Protein NP_001129049.1
small integral membrane protein 13
Mus musculus
Gene Smim13, UniProt E9Q942
>NP_001129049.1|Yersinia pseudotuberculosis IP 32953|small integral membrane protein 13
MWHNVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDNEQPSGSETEEDPSASPQKIRSARQRRPPVDAGH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.89 | 0.892644713037277 | 0.0083 | 28096329 | |
Retrieved 1 of 1 entries in 10.3 ms
(Link to these results)