Host taxon 10090
Protein NP_001239401.1
SLAM family member 5 isoform 2 precursor
Mus musculus
Gene Cd84, UniProt Q18PI6
>NP_001239401.1|Yersinia pseudotuberculosis IP 32953|SLAM family member 5 isoform 2 precursor
MAQRHLWIWFLCLQTWSEAAGKDADPVVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRKLWQHGALDLLLI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.67 | 1.67066855351419 | 1.3e-9 | 28096329 | |
Retrieved 1 of 4 entries in 0.9 ms
(Link to these results)