Host taxon 10090
Protein NP_033775.1
single-stranded DNA cytosine deaminase
Mus musculus
Gene Aicda, UniProt Q9WVE0
>NP_033775.1|Yersinia pseudotuberculosis IP 32953|single-stranded DNA cytosine deaminase
MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.76 | -1.7563007251637 | 5.0e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)