Host taxon 10090
Protein NP_573477.2
single-pass membrane and coiled-coil domain-containing protein 4
Mus musculus
Gene Smco4, UniProt Q9JIS3
>NP_573477.2|Yersinia pseudotuberculosis IP 32953|single-pass membrane and coiled-coil domain-containing protein 4
MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPAVTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.02 | -1.02125645437747 | 0.021 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)