Host taxon 10090
Protein NP_062309.2
signaling threshold-regulating transmembrane adapter 1
Mus musculus
Gene Sit1, UniProt Q8C503
>NP_062309.2|Yersinia pseudotuberculosis IP 32953|signaling threshold-regulating transmembrane adapter 1
MSRDYNCTTDDQLAWGIPSISHAWGLWALLGVVTVLLLISLAALLSQWTRGRRRNQEGQGPLSGRSAEEVPLYGNLHYLQTGRLSQEPRSEEQDPPSSGGLARGAEEAMCYTSLQLRPAQGRIPSSGNPIKYCEVVLDSEPKPQAPGPEPELYASVCAQTRRGRASFPDQAYANSQPAPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.63 | -1.62854383578255 | 0.0018 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)