Host taxon 10090
Protein NP_035445.1
serum amyloid A-3 protein precursor
Mus musculus
Gene Saa3, UniProt P04918
>NP_035445.1|Yersinia pseudotuberculosis IP 32953|serum amyloid A-3 protein precursor
MKPSIAIILCILILGVDSQRWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6,43 | 6.43083218985186 | 5,5e-178 | 28096329 | |
Retrieved 1 of 1 entries in 0,5 ms
(Link to these results)