Host taxon 10090
Protein NP_033143.1
serum amyloid A-1 protein precursor
Mus musculus
Gene Saa1, UniProt P05366
>NP_033143.1|Yersinia pseudotuberculosis IP 32953|serum amyloid A-1 protein precursor
MKLLTSLVFCSLLLGVCHGGFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.45 | 1.45215628575284 | 0.0071 | 28096329 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)