Host taxon 10090
Protein NP_079849.1
serine/arginine-rich splicing factor 9
Mus musculus
Gene Srsf9, UniProt Q9D0B0
>NP_079849.1|Yersinia pseudotuberculosis IP 32953|serine/arginine-rich splicing factor 9
MSSGWADERGGEGDGRIYVGNLPSDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGARNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.54 | 0.544209456944153 | 0.03 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)