Host taxon 10090
Protein NP_035593.2
serine protease inhibitor Kazal-type 4 precursor
Mus musculus
Gene Spink4, UniProt O35679
>NP_035593.2|Yersinia pseudotuberculosis IP 32953|serine protease inhibitor Kazal-type 4 precursor
MAMHLWLVTLTLVPLLGMDRELMVSAGSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.65 | -1.65442669283201 | 3.4e-9 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)