Host taxon 10090
Protein NP_033284.1
serine protease inhibitor Kazal-type 1 precursor
Mus musculus
Gene Spink1, UniProt P09036
>NP_033284.1|Yersinia pseudotuberculosis IP 32953|serine protease inhibitor Kazal-type 1 precursor
MKVAVIFLLSALALLSLAGNTFSAKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.97 | -2.97159689719088 | 1.1e-31 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)