Host taxon 10090
Protein NP_083016.1
serine protease inhibitor A3A isoform 2
Mus musculus
Gene Serpina3a, UniProt Q6P4P1
>NP_083016.1|Yersinia pseudotuberculosis IP 32953|serine protease inhibitor A3A isoform 2
MRTVWLFQMFPFLLGPNIRQELLEGFWNVTFDPEDTFLGNFTLDRKRTVNVPMMKTEELTTNYFRDEEMQSTVMELNYIGNASFLFILPDQGRIQHVEDSLQPQSLRKWRKSLRPRMLDELSLPKFSLSQDYNLNDILPELGIKEVFSTQADLSGITGAKNIRVSQMIHQAALDVTETHTEADVITIARYNFQSAKIKAKIVKVDREFLYLILDPMFKSISVMGKVINPLTN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -5.6 | -5.5963306004816 | 0.025 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)