Host taxon 10090
Protein NP_035287.1
serglycin precursor
Mus musculus
Gene Srgn, UniProt P13609
>NP_035287.1|Yersinia pseudotuberculosis IP 32953|serglycin precursor
MQVPVGSRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPNGFFANCIEEKGPQFDLIDESNNIGPPMNNPVLMEGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.45 | 1.44942225141763 | 2.4e-6 | 28096329 | |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)