Host taxon 10090
Protein NP_001288563.1
secretory carrier-associated membrane protein 5 isoform 1
Mus musculus
Gene Scamp5, UniProt Q9JKD3
>NP_001288563.1|Yersinia pseudotuberculosis IP 32953|secretory carrier-associated membrane protein 5 isoform 1
MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVVAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.82 | -0.819003443042123 | 1.6e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)