Host taxon 10090
Protein NP_081183.3
secreted and transmembrane protein 1b precursor
Mus musculus
Gene Sectm1b, UniProt Q9D966
>NP_081183.3|Yersinia pseudotuberculosis IP 32953|secreted and transmembrane protein 1b precursor
MLAYSVTSSGLFPRMLWALLLLAASLNAYNHVWDKPCCTEHEVSVNRGSRVVMACNISNNLRDVTIELVTSKKTSIIFNQTPPGNYSKDSWQLHIQGGQAQLVITDAQGKHSGEYWWKLRGFQAEFKNFNLIVNAADRQKTEDLPVTKVPDKPPTAVRTEVIIIIAIATTIIITGIGVFVWYKQFPVAPQIQMSVPCLIHGSPGIPYLTLPP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.06 | -3.05556489514749 | 2.2e-54 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)