Host taxon 10090
Protein NP_082908.2
rRNA-processing protein FCF1 homolog
Mus musculus
Gene Fcf1, UniProt Q9CTH6
>NP_082908.2|Yersinia pseudotuberculosis IP 32953|rRNA-processing protein FCF1 homolog
MGKQKKTRKYATMKRMLSLRDERLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKFRVALRIAKDPRFDRLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYLSNHRYNIERMPDDYGAPRF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.88 | 0.875169467287748 | 0.0049 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)