Bacterial taxon 273123
Protein WP_002210113.1
RNase adapter RapZ
Yersinia pseudotuberculosis IP 32953
Gene rapZ, UniProt Q665I8
>WP_002210113.1|Yersinia pseudotuberculosis IP 32953|RNase adapter RapZ
MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPQLASTLADRNISAAVSIDVRNMPESPEVFEHAMTQLPDSFSPQLLFLDADRNTLIRRYSDTRRLHPLSAKNLSLESAIDEESDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVISFLDRHTEVHNFIYQTRSYLEQWLPMLETNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRARGKNVQSRHRTLEKRKQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.21 | 1.20548072111467 | 0.016 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.05 | 1.04551671481351 | 0.037 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.9 | -0.903349861940556 | 0.0034 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.78 | -0.776584262845713 | 0.0074 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 1.3 ms
(Link to these results)